FAM3A (NM_001171133) Human Recombinant Protein
CAT#: TP329664
Purified recombinant protein of Homo sapiens family with sequence similarity 3, member A (FAM3A), transcript variant 3, 20 µg
View other "FAM3A" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229664 representing NM_001171133
Red=Cloning site Green=Tags(s) MRLAGPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIA LVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELA FRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.6 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001164604 |
| Locus ID | 60343 |
| UniProt ID | P98173 |
| Cytogenetics | Xq28 |
| Refseq ORF | 576 |
| Synonyms | 2.19; DLD; DXS560S; XAP-7 |
| Summary | This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411913 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432664 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411913 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 1 |
CNY 3080.00 |
|
| LY432664 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 3 |
CNY 3080.00 |
|
| PH303495 | FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578) |
CNY 19520.00 |
|
| TP303495 | Recombinant protein of human family with sequence similarity 3, member A (FAM3A), 20 µg |
CNY 2900.00 |


