IRF1 (NM_002198) Human Mass Spec Standard
CAT#: PH303500
IRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002189)
View other "IRF1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | IRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002189) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203500 |
Predicted MW | 36.5 kDa |
Protein Sequence |
>RC203500 protein sequence
Red=Cloning site Green=Tags(s) MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002189 |
RefSeq Size | 3567 |
RefSeq ORF | 975 |
Synonyms | IRF-1; MAR |
Locus ID | 3659 |
Cytogenetics | 5q31.1 |
Summary | The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419474 | IRF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419474 | Transient overexpression lysate of interferon regulatory factor 1 (IRF1) |
CNY 3080.00 |
|
TP303500 | Recombinant protein of human interferon regulatory factor 1 (IRF1), 20 µg |
CNY 2900.00 |