TCEAL3 (NM_001006933) Human Mass Spec Standard
CAT＃: PH303524
TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_001006934)
View other "TCEAL3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_001006934) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203524 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC203524 protein sequence
Red=Cloning site Green=Tags(s) MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001006934 |
| RefSeq Size | 1154 |
| RefSeq ORF | 600 |
| Synonyms | WEX8 |
| Locus ID | 85012 |
| Cytogenetics | Xq22.2 |
| Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409871 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423552 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409871 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2 |
CNY 3080.00 |
|
| LY423552 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 |
CNY 3080.00 |
|
| PH318119 | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_116315) |
CNY 19520.00 |
|
| TP303524 | Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318119 | Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2, 20 µg |
CNY 2900.00 |
Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, 100 µg
