TCEAL3 (NM_032926) Human Recombinant Protein
CAT#: TP318119
Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2, 20 µg
View other "TCEAL3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218119 protein sequence
Red=Cloning site Green=Tags(s) MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116315 |
Locus ID | 85012 |
UniProt ID | Q969E4 |
Refseq Size | 1142 |
Cytogenetics | Xq22.2 |
Refseq ORF | 600 |
Synonyms | WEX8 |
Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409871 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423552 | TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409871 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2 |
CNY 3080.00 |
|
LY423552 | Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 |
CNY 3080.00 |
|
PH303524 | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_001006934) |
CNY 19520.00 |
|
PH318119 | TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_116315) |
CNY 19520.00 |
|
TP303524 | Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, 20 µg |
CNY 2900.00 |