IFT43 (NM_052873) Human Mass Spec Standard
CAT#: PH303591
C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105)
View other "IFT43" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203591 |
Predicted MW | 23.9 kDa |
Protein Sequence |
>RC203591 protein sequence
Red=Cloning site Green=Tags(s) MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA RHT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443105 |
RefSeq Size | 865 |
RefSeq ORF | 639 |
Synonyms | C14orf179; CED3; RP81; SRTD18 |
Locus ID | 112752 |
Cytogenetics | 14q24.3 |
Summary | This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409416 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420159 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409416 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 |
CNY 3080.00 |
|
LY420159 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 |
CNY 3080.00 |
|
TP303591 | Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1, 20 µg |
CNY 2900.00 |