IFT43 (NM_052873) Human Recombinant Protein
CAT#: TP303591
Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1, 20 µg
View other "IFT43" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203591 protein sequence
Red=Cloning site Green=Tags(s) MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA RHT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443105 |
Locus ID | 112752 |
UniProt ID | Q96FT9 |
Refseq Size | 865 |
Cytogenetics | 14q24.3 |
Refseq ORF | 639 |
Synonyms | C14orf179; CED3; RP81; SRTD18 |
Summary | This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409416 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420159 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409416 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 |
CNY 3080.00 |
|
LY420159 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 |
CNY 3080.00 |
|
PH303591 | C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105) |
CNY 19520.00 |