MAT1A (NM_000429) Human Mass Spec Standard
CAT#: PH303765
MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420)
View other "MAT1A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203765 |
| Predicted MW | 43.6 kDa |
| Protein Sequence |
>RC203765 protein sequence
Red=Cloning site Green=Tags(s) MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000420 |
| RefSeq Size | 3419 |
| RefSeq ORF | 1185 |
| Synonyms | MAT; MATA1; SAMS; SAMS1 |
| Locus ID | 4143 |
| Cytogenetics | 10q22.3 |
| Summary | This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. The encoded protein is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in this gene are associated with methionine adenosyltransferase deficiency. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400152 | MAT1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400152 | Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A) |
CNY 3080.00 |
|
| TP303765 | Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 20 µg |
CNY 2900.00 |
