C5R1 (C5AR1) (NM_001736) Human Mass Spec Standard
CAT#: PH303784
C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727)
View other "C5R1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC203784 | 
| Predicted MW | 39.3 kDa | 
| Protein Sequence | 
                 >RC203784 protein sequence 
Red=Cloning site Green=Tags(s) MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001727 | 
| RefSeq Size | 2342 | 
| RefSeq ORF | 1050 | 
| Synonyms | C5A; C5AR; C5R1; CD88 | 
| Locus ID | 728 | 
| Cytogenetics | 19q13.32 | 
| Summary | Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:1847994, PubMed:8182049, PubMed:7622471, PubMed:9553099, PubMed:10636859, PubMed:15153520, PubMed:29300009). The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events (PubMed:8182049, PubMed:7622471, PubMed:9553099). Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production (PubMed:10636859, PubMed:15153520).[UniProtKB/Swiss-Prot Function] | 
| Protein Families | Druggable Genome, GPCR, Transmembrane | 
| Protein Pathways | Complement and coagulation cascades, Neuroactive ligand-receptor interaction | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400657 | C5AR1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400657 | Transient overexpression lysate of complement component 5a receptor 1 (C5AR1) | 
                                                     CNY 3080.00  | 
                                            |
| TP303784 | Recombinant protein of human complement component 5a receptor 1 (C5AR1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
