C5R1 (C5AR1) (NM_001736) Human Recombinant Protein
CAT#: TP303784
Recombinant protein of human complement component 5a receptor 1 (C5AR1), 20 µg
View other "C5R1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203784 protein sequence
Red=Cloning site Green=Tags(s) MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 29981048) |
Reference Data | |
RefSeq | NP_001727 |
Locus ID | 728 |
UniProt ID | P21730 |
Refseq Size | 2342 |
Cytogenetics | 19q13.32 |
Refseq ORF | 1050 |
Synonyms | C5A; C5AR; C5R1; CD88 |
Summary | Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:1847994, PubMed:8182049, PubMed:7622471, PubMed:9553099, PubMed:10636859, PubMed:15153520, PubMed:29300009). The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events (PubMed:8182049, PubMed:7622471, PubMed:9553099). Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production (PubMed:10636859, PubMed:15153520).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Complement and coagulation cascades, Neuroactive ligand-receptor interaction |
Shipping | Dry Ice |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Paclitaxel binds and activates C5aR1: A new potential therapeutic target for the prevention of chemotherapy-induced peripheral neuropathy and hypersensitivity reactions
,null,
Cell Death & Disease
,PubMed ID 35614037
[C5AR1]
|
Aptamers that bind to the human complement component receptor hC5aR1 interfere with hC5aR1 interaction to its hC5a ligand
,Kumar, PKR;,
Mol. Biol. Rep.
,PubMed ID 29981048
[C5AR1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400657 | C5AR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400657 | Transient overexpression lysate of complement component 5a receptor 1 (C5AR1) |
CNY 3080.00 |
|
PH303784 | C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727) |
CNY 19520.00 |