PCP4 (NM_006198) Human Mass Spec Standard
CAT#: PH303796
PCP4 MS Standard C13 and N15-labeled recombinant protein (NP_006189)
View other "PCP4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PCP4 MS Standard C13 and N15-labeled recombinant protein (NP_006189) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203796 |
| Predicted MW | 6.8 kDa |
| Protein Sequence |
>RC203796 protein sequence
Red=Cloning site Green=Tags(s) MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006189 |
| RefSeq Size | 566 |
| RefSeq ORF | 186 |
| Synonyms | PEP-19 |
| Locus ID | 5121 |
| Cytogenetics | 21q22.2 |
| Summary | Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416805 | PCP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416805 | Transient overexpression lysate of Purkinje cell protein 4 (PCP4) |
CNY 3080.00 |
|
| TP303796 | Recombinant protein of human Purkinje cell protein 4 (PCP4), 20 µg |
CNY 2900.00 |
