PCP4 (NM_006198) Human Recombinant Protein
CAT#: TP303796
Recombinant protein of human Purkinje cell protein 4 (PCP4), 20 µg
View other "PCP4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203796 protein sequence
Red=Cloning site Green=Tags(s) MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 6.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006189 |
| Locus ID | 5121 |
| UniProt ID | P48539 |
| Refseq Size | 566 |
| Cytogenetics | 21q22.2 |
| Refseq ORF | 186 |
| Synonyms | PEP-19 |
| Summary | Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways (PubMed:21491429).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
