POLR3K (NM_016310) Human Mass Spec Standard
CAT#: PH304102
POLR3K MS Standard C13 and N15-labeled recombinant protein (NP_057394)
View other "POLR3K" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | POLR3K MS Standard C13 and N15-labeled recombinant protein (NP_057394) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204102 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC204102 protein sequence
Red=Cloning site Green=Tags(s) MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057394 |
RefSeq Size | 834 |
RefSeq ORF | 324 |
Synonyms | C11; C11-RNP3; HLD21; My010; RPC10; RPC11; RPC12.5 |
Locus ID | 51728 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010] |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414047 | POLR3K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414047 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K) |
CNY 3080.00 |
|
TP304102 | Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K), 20 µg |
CNY 2900.00 |