POLR3K (NM_016310) Human Recombinant Protein
CAT#: TP304102
Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K), 20 µg
View other "POLR3K" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204102 protein sequence
Red=Cloning site Green=Tags(s) MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057394 |
| Locus ID | 51728 |
| UniProt ID | Q9Y2Y1 |
| Refseq Size | 834 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 324 |
| Synonyms | C11; C11-RNP3; HLD21; My010; RPC10; RPC11; RPC12.5 |
| Summary | This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414047 | POLR3K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414047 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K) |
CNY 3080.00 |
|
| PH304102 | POLR3K MS Standard C13 and N15-labeled recombinant protein (NP_057394) |
CNY 19520.00 |
