HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard
CAT#: PH304419
HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212)
View other "HDHD1A" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204419 |
Predicted MW | 23.8 kDa |
Protein Sequence |
>RC204419 protein sequence
Red=Cloning site Green=Tags(s) MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL PSYE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036212 |
RefSeq Size | 2155 |
RefSeq ORF | 642 |
Synonyms | DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A |
Locus ID | 8226 |
Cytogenetics | Xp22.31 |
Summary | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415984 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432645 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415984 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 |
CNY 3080.00 |
|
LY432645 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 |
CNY 3080.00 |
|
TP304419 | Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg |
CNY 2900.00 |