HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard
CAT#: PH304419
HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212)
View other "HDHD1A" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204419 |
| Predicted MW | 23.8 kDa |
| Protein Sequence |
>RC204419 protein sequence
Red=Cloning site Green=Tags(s) MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL PSYE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036212 |
| RefSeq Size | 2155 |
| RefSeq ORF | 642 |
| Synonyms | DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A |
| Locus ID | 8226 |
| Cytogenetics | Xp22.31 |
| Summary | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415984 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432645 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415984 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 |
CNY 3080.00 |
|
| LY432645 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 |
CNY 3080.00 |
|
| TP304419 | Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg |
CNY 2900.00 |
