SMPDL3B (NM_001009568) Human Mass Spec Standard
CAT#: PH304846
SMPDL3B MS Standard C13 and N15-labeled recombinant protein (NP_001009568)
View other "SMPDL3B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SMPDL3B MS Standard C13 and N15-labeled recombinant protein (NP_001009568) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204846 |
| Predicted MW | 41.7 kDa |
| Protein Sequence |
>RC204846 protein sequence
Red=Cloning site Green=Tags(s) MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL KCITTFPHSQLIHLPLTTEPQEG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001009568 |
| RefSeq Size | 1611 |
| RefSeq ORF | 1119 |
| Synonyms | ASML3B |
| Locus ID | 27293 |
| Cytogenetics | 1p35.3 |
| Summary | Lipid-modulating phosphodiesterase (PubMed:26095358). Active on the surface of macrophages and dendritic cells and strongly influences macrophage lipid composition and membrane fluidity. Acts as a negative regulator of Toll-like receptor signaling (By similarity). Has in vitro phosphodiesterase activity, but the physiological substrate is unknown (PubMed:26095358). Lacks activity with phosphocholine-containing lipids, but can cleave CDP-choline, and can release phosphate from ATP and ADP (in vitro) (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415256 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422916 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429425 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415256 | Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 1 |
CNY 4840.00 |
|
| LY422916 | Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2 |
CNY 3080.00 |
|
| TP304846 | Recombinant protein of human sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2, 20 µg |
CNY 2900.00 |
其它SMPDL3B产品
