SMPDL3B (NM_001009568) Human Recombinant Protein
CAT#: TP304846
Recombinant protein of human sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2, 20 µg
View other "SMPDL3B" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204846 protein sequence
Red=Cloning site Green=Tags(s) MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGL KCITTFPHSQLIHLPLTTEPQEG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009568 |
Locus ID | 27293 |
UniProt ID | Q92485 |
Refseq Size | 1611 |
Cytogenetics | 1p35.3 |
Refseq ORF | 1119 |
Synonyms | ASML3B |
Summary | Lipid-modulating phosphodiesterase (PubMed:26095358). Active on the surface of macrophages and dendritic cells and strongly influences macrophage lipid composition and membrane fluidity. Acts as a negative regulator of Toll-like receptor signaling (By similarity). Has in vitro phosphodiesterase activity, but the physiological substrate is unknown (PubMed:26095358). Lacks activity with phosphocholine-containing lipids, but can cleave CDP-choline, and can release phosphate from ATP and ADP (in vitro) (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415256 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC422916 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429425 | SMPDL3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415256 | Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 1 |
CNY 4840.00 |
|
LY422916 | Transient overexpression lysate of sphingomyelin phosphodiesterase, acid-like 3B (SMPDL3B), transcript variant 2 |
CNY 3080.00 |
|
PH304846 | SMPDL3B MS Standard C13 and N15-labeled recombinant protein (NP_001009568) |
CNY 19520.00 |
其它SMPDL3B产品