BACE2 (NM_012105) Human Mass Spec Standard
CAT＃: PH304860
BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)
View other "BACE2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204860 |
| Predicted MW | 56.18 kDa |
| Protein Sequence |
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s) MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL LLPFRCQRRPRDPEVVNDESSLVRHRWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036237 |
| RefSeq Size | 2993 |
| RefSeq ORF | 1554 |
| Synonyms | AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP |
| Locus ID | 25825 |
| Cytogenetics | 21q22.2-q22.3 |
| Summary | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408426 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408427 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415975 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408426 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c |
CNY 4840.00 |
|
| LY408427 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b |
CNY 3080.00 |
|
| LY415975 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a |
CNY 3080.00 |
|
| TP304860 | Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 20 µg |
CNY 2900.00 |
