BACE2 (NM_012105) Human Recombinant Protein
CAT＃: TP304860
Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 20 µg
View other "BACE2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s) MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL LLPFRCQRRPRDPEVVNDESSLVRHRWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036237 |
| Locus ID | 25825 |
| UniProt ID | Q9Y5Z0 |
| Refseq Size | 2993 |
| Cytogenetics | 21q22.2-q22.3 |
| Refseq ORF | 1554 |
| Synonyms | AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP |
| Summary | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408426 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC408427 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415975 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408426 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c |
CNY 4840.00 |
|
| LY408427 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b |
CNY 3080.00 |
|
| LY415975 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a |
CNY 3080.00 |
|
| PH304860 | BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237) |
CNY 19520.00 |
