GRO beta (CXCL2) (NM_002089) Human Mass Spec Standard
CAT#: PH304877
CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080)
View other "GRO beta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204877 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC204877 protein sequence
Red=Cloning site Green=Tags(s) MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002080 |
RefSeq Size | 1234 |
RefSeq ORF | 321 |
Synonyms | CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2 |
Locus ID | 2920 |
Cytogenetics | 4q13.3 |
Summary | This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP304877 | Recombinant protein of human chemokine (C-X-C motif) ligand 2 (CXCL2), 20 µg |
CNY 2900.00 |
|
TP720606 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
CNY 1800.00 |
|
TP723792 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2 / Grobeta) |
CNY 4970.00 |
其它GRO beta产品