GRO beta (CXCL2) (NM_002089) Human Recombinant Protein
CAT#: TP304877
Recombinant protein of human chemokine (C-X-C motif) ligand 2 (CXCL2), 20 µg
View other "GRO beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204877 protein sequence
Red=Cloning site Green=Tags(s) MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002080 |
Locus ID | 2920 |
UniProt ID | P19875 |
Refseq Size | 1234 |
Cytogenetics | 4q13.3 |
Refseq ORF | 321 |
Synonyms | CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2 |
Summary | This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH304877 | CXCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002080) |
CNY 19520.00 |
|
TP720606 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
CNY 1800.00 |
|
TP723792 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2 / Grobeta) |
CNY 4970.00 |
其它GRO beta产品