SPAG6 (NM_172242) Human Mass Spec Standard
CAT#: PH305275
SPAG6 MS Standard C13 and N15-labeled recombinant protein (NP_758442)
View other "SPAG6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPAG6 MS Standard C13 and N15-labeled recombinant protein (NP_758442) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205275 |
Predicted MW | 49.6 kDa |
Protein Sequence |
>RC205275 protein sequence
Red=Cloning site Green=Tags(s) MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQIAALALGRLAN YNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG VKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKGIAASALSDIVKHSPELAQTVVDAGA VAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAK HTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPF LYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLSTT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_758442 |
RefSeq Size | 2488 |
RefSeq ORF | 1374 |
Synonyms | CFAP194; CT141; FAP194; pf16; Repro-SA-1 |
Locus ID | 9576 |
Cytogenetics | 10p12.2 |
Summary | The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406761 | SPAG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415763 | SPAG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY406761 | Transient overexpression lysate of sperm associated antigen 6 (SPAG6), transcript variant 2 |
CNY 3080.00 |
|
LY415763 | Transient overexpression lysate of sperm associated antigen 6 (SPAG6), transcript variant 1 |
CNY 4840.00 |
|
TP305275 | Recombinant protein of human sperm associated antigen 6 (SPAG6), transcript variant 2, 20 µg |
CNY 2900.00 |