SPAG6 (NM_172242) Human Recombinant Protein
CAT#: TP305275
Recombinant protein of human sperm associated antigen 6 (SPAG6), transcript variant 2, 20 µg
View other "SPAG6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205275 protein sequence
Red=Cloning site Green=Tags(s) MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQIAALALGRLAN YNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG VKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKGIAASALSDIVKHSPELAQTVVDAGA VAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAK HTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPF LYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLSTT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_758442 |
| Locus ID | 9576 |
| UniProt ID | O75602 |
| Refseq Size | 2488 |
| Cytogenetics | 10p12.2 |
| Refseq ORF | 1374 |
| Synonyms | CFAP194; CT141; FAP194; pf16; Repro-SA-1 |
| Summary | The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406761 | SPAG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415763 | SPAG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406761 | Transient overexpression lysate of sperm associated antigen 6 (SPAG6), transcript variant 2 |
CNY 3080.00 |
|
| LY415763 | Transient overexpression lysate of sperm associated antigen 6 (SPAG6), transcript variant 1 |
CNY 4840.00 |
|
| PH305275 | SPAG6 MS Standard C13 and N15-labeled recombinant protein (NP_758442) |
CNY 19520.00 |
