HORMAD2 (NM_152510) Human Mass Spec Standard
CAT#: PH305453
HORMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_689723)
View other "HORMAD2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HORMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_689723) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205453 |
| Predicted MW | 35.3 kDa |
| Protein Sequence |
>RC205453 protein sequence
Red=Cloning site Green=Tags(s) MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV CSQQSSECSRKKRKVSEPVKVFIPNRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689723 |
| RefSeq Size | 1909 |
| RefSeq ORF | 921 |
| Synonyms | CT46.2 |
| Locus ID | 150280 |
| Cytogenetics | 22q12.2 |
| Summary | Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407512 | HORMAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407512 | Transient overexpression lysate of HORMA domain containing 2 (HORMAD2) |
CNY 3080.00 |
|
| TP305453 | Recombinant protein of human HORMA domain containing 2 (HORMAD2), 20 µg |
CNY 2900.00 |
其它HORMAD2产品
