HORMAD2 (NM_152510) Human Recombinant Protein
CAT#: TP305453
Recombinant protein of human HORMA domain containing 2 (HORMAD2), 20 µg
View other "HORMAD2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205453 protein sequence
Red=Cloning site Green=Tags(s) MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV CSQQSSECSRKKRKVSEPVKVFIPNRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689723 |
| Locus ID | 150280 |
| UniProt ID | Q8N7B1 |
| Refseq Size | 1909 |
| Cytogenetics | 22q12.2 |
| Refseq ORF | 921 |
| Synonyms | CT46.2 |
| Summary | Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407512 | HORMAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407512 | Transient overexpression lysate of HORMA domain containing 2 (HORMAD2) |
CNY 3080.00 |
|
| PH305453 | HORMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_689723) |
CNY 19520.00 |
其它HORMAD2产品
