CT45A5 (NM_001007551) Human Mass Spec Standard
CAT#: PH305570
CT45A5 MS Standard C13 and N15-labeled recombinant protein (NP_001007552)
View other "CT45A5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CT45A5 MS Standard C13 and N15-labeled recombinant protein (NP_001007552) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205570 |
| Predicted MW | 21.3 kDa |
| Protein Sequence |
>RC205570 protein sequence
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001007552 |
| RefSeq Size | 1321 |
| RefSeq ORF | 567 |
| Synonyms | CT45-3; CT45-4; CT45-6; CT45.5; CT45A3; CT45A4; CT45A6; CT45A7; CT455 |
| Locus ID | 441521 |
| Cytogenetics | Xq26.3 |
| Summary | This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423509 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432655 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423509 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 1 |
CNY 3080.00 |
|
| LY432655 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2 |
CNY 3080.00 |
|
| TP305570 | Recombinant protein of human cancer/testis antigen family 45, member A5 (CT45A5), 20 µg |
CNY 2900.00 |
|
| TP329655 | Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2, 20 µg |
CNY 2900.00 |
