CT45A5 (NM_001172288) Human Recombinant Protein
CAT#: TP329655
Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2, 20 µg
View other "CT45A5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229655 representing NM_001172288
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDGMMQKPGSNAPVGGNVTSNFSGDDLECRGIASSPKSQQEINADIKCQVVKEIRCLGRK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.7 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001165759 |
| Locus ID | 441521 |
| UniProt ID | P0DMU8 |
| Cytogenetics | Xq26.3 |
| Refseq ORF | 567 |
| Synonyms | CT45-3; CT45-4; CT45-6; CT45.5; CT45A3; CT45A4; CT45A6; CT45A7; CT455 |
| Summary | This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423509 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432655 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423509 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 1 |
CNY 3080.00 |
|
| LY432655 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2 |
CNY 3080.00 |
|
| PH305570 | CT45A5 MS Standard C13 and N15-labeled recombinant protein (NP_001007552) |
CNY 19520.00 |
|
| TP305570 | Recombinant protein of human cancer/testis antigen family 45, member A5 (CT45A5), 20 µg |
CNY 2900.00 |
