ZCCHC13 (NM_203303) Human Mass Spec Standard
CAT#: PH306078
ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048)
View other "ZCCHC13" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206078 |
| Predicted MW | 18 kDa |
| Protein Sequence |
>RC206078 protein sequence
Red=Cloning site Green=Tags(s) MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA INCSKARPGQLLPLRQIPTSSQGMSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_976048 |
| RefSeq Size | 859 |
| RefSeq ORF | 498 |
| Synonyms | CNBP2; ZNF9L |
| Locus ID | 389874 |
| Cytogenetics | Xq13.2 |
| Summary | This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. [provided by RefSeq, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404386 | ZCCHC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404386 | Transient overexpression lysate of zinc finger, CCHC domain containing 13 (ZCCHC13) |
CNY 3080.00 |
|
| TP306078 | Recombinant protein of human zinc finger, CCHC domain containing 13 (ZCCHC13), 20 µg |
CNY 2900.00 |
|
| TP762528 | Purified recombinant protein of Human zinc finger, CCHC domain containing 13 (ZCCHC13), full length, 50ug |
CNY 2480.00 |
其它ZCCHC13产品
