ZCCHC13 (NM_203303) Human Recombinant Protein
CAT#: TP306078
Recombinant protein of human zinc finger, CCHC domain containing 13 (ZCCHC13), 20 µg
View other "ZCCHC13" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206078 protein sequence
Red=Cloning site Green=Tags(s) MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA INCSKARPGQLLPLRQIPTSSQGMSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_976048 |
| Locus ID | 389874 |
| UniProt ID | Q8WW36 |
| Refseq Size | 859 |
| Cytogenetics | Xq13.2 |
| Refseq ORF | 498 |
| Synonyms | CNBP2; ZNF9L |
| Summary | This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. [provided by RefSeq, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404386 | ZCCHC13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404386 | Transient overexpression lysate of zinc finger, CCHC domain containing 13 (ZCCHC13) |
CNY 3080.00 |
|
| PH306078 | ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048) |
CNY 19520.00 |
|
| TP762528 | Purified recombinant protein of Human zinc finger, CCHC domain containing 13 (ZCCHC13), full length, 50ug |
CNY 2480.00 |
其它ZCCHC13产品
