RALYL (NM_173848) Human Mass Spec Standard
CAT＃: PH306313
RALYL MS Standard C13 and N15-labeled recombinant protein (NP_776247)
View other "RALYL" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RALYL MS Standard C13 and N15-labeled recombinant protein (NP_776247) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206313 |
| Predicted MW | 32.3 kDa |
| Protein Sequence |
>RC206313 protein sequence
Red=Cloning site Green=Tags(s) MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARA AVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLF DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKI DSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDE DGGHELFLQIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_776247 |
| RefSeq Size | 2919 |
| RefSeq ORF | 873 |
| Synonyms | HNRPCL3 |
| Locus ID | 138046 |
| Cytogenetics | 8q21.2 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406284 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420244 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420245 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406284 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 3 |
CNY 3080.00 |
|
| LY420244 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 2 |
CNY 3080.00 |
|
| LY420245 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 4 |
CNY 3080.00 |
|
| TP306313 | Recombinant protein of human RALY RNA binding protein-like (RALYL), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP760706 | Purified recombinant protein of Human RALY RNA binding protein-like (RALYL), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
