RALYL (NM_173848) Human Recombinant Protein
CAT#: TP306313
Recombinant protein of human RALY RNA binding protein-like (RALYL), transcript variant 3, 20 µg
View other "RALYL" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206313 protein sequence
Red=Cloning site Green=Tags(s) MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARA AVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLF DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKI DSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDE DGGHELFLQIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776247 |
Locus ID | 138046 |
UniProt ID | Q86SE5 |
Refseq Size | 2919 |
Cytogenetics | 8q21.2 |
Refseq ORF | 873 |
Synonyms | HNRPCL3 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406284 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420244 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420245 | RALYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406284 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 3 |
CNY 3080.00 |
|
LY420244 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 2 |
CNY 3080.00 |
|
LY420245 | Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 4 |
CNY 3080.00 |
|
PH306313 | RALYL MS Standard C13 and N15-labeled recombinant protein (NP_776247) |
CNY 19520.00 |
|
TP760706 | Purified recombinant protein of Human RALY RNA binding protein-like (RALYL), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |