Ornithine Decarboxylase (ODC1) (NM_002539) Human Mass Spec Standard
CAT#: PH306858
ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530)
View other "Ornithine Decarboxylase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206858 |
| Predicted MW | 51.1 kDa |
| Protein Sequence |
>RC206858 protein sequence
Red=Cloning site Green=Tags(s) MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002530 |
| RefSeq Size | 2307 |
| RefSeq ORF | 1383 |
| Synonyms | BABS; NEDBA; NEDBIA; ODC |
| Locus ID | 4953 |
| Cytogenetics | 2p25.1 |
| Summary | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400909 | ODC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400909 | Transient overexpression lysate of ornithine decarboxylase 1 (ODC1) |
CNY 3080.00 |
|
| TP306858 | Recombinant protein of human ornithine decarboxylase 1 (ODC1), 20 µg |
CNY 2900.00 |
|
| TP721016 | Purified recombinant protein of Human ornithine decarboxylase 1 (ODC1) |
CNY 1800.00 |
其它Ornithine Decarboxylase产品
