Ornithine Decarboxylase (ODC1) (NM_002539) Human Recombinant Protein
CAT#: TP306858
Recombinant protein of human ornithine decarboxylase 1 (ODC1), 20 µg
View other "Ornithine Decarboxylase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206858 protein sequence
Red=Cloning site Green=Tags(s) MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme activity (PMID: 27257787) Enzyme activity (PMID: 28346093) |
| Reference Data | |
| RefSeq | NP_002530 |
| Locus ID | 4953 |
| UniProt ID | P11926 |
| Refseq Size | 2307 |
| Cytogenetics | 2p25.1 |
| Refseq ORF | 1383 |
| Synonyms | BABS; NEDBA; NEDBIA; ODC |
| Summary | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
A Label-Free Continuous Fluorescence-Based Assay for Monitoring Ornithine Decarboxylase Activity with a Synthetic Putrescine Receptor
,Nilam, M;Gribbon, P;Reinshagen, J;Cordts, K;Schwedhelm, E;Nau, WM;Hennig, A;,
SLAS Discovery
,PubMed ID 28346093
[ODC1]
|
|
Cystathionine-beta-synthase inhibition for colon cancer: Enhancement of the efficacy of aminooxyacetic acid via the prodrug approach
,Chao, C;Zatarain, JR;Ding, Y;Coletta, C;Mrazek, AA;Druzhyna, N;Johnson, P;Chen, H;Hellmich, JL;Asimakopoulou, A;Yanagi, K;Olah, G;Szoleczky, P;Törö, G;Bohanon, FJ;Cheema, M;Lewis, R;Eckelbarger, D;Ahmad, A;Módis, K;Untereiner, A;Szczesny, B;Papapetropoulos, A;Zhou, J;Hellmich, MR;Szabo, C;,
Mol. Med.
,PubMed ID 27257787
[ODC1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400909 | ODC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400909 | Transient overexpression lysate of ornithine decarboxylase 1 (ODC1) |
CNY 3080.00 |
|
| PH306858 | ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530) |
CNY 19520.00 |
|
| TP721016 | Purified recombinant protein of Human ornithine decarboxylase 1 (ODC1) |
CNY 1800.00 |
其它Ornithine Decarboxylase产品


