TMUB1 (NM_031434) Human Mass Spec Standard
CAT#: PH307700
TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_113622)
View other "TMUB1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_113622) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207700 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC207700 representing NM_031434
Red=Cloning site Green=Tags(s) MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAE TPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQV RLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLL WYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_113622 |
RefSeq Size | 1494 |
RefSeq ORF | 738 |
Synonyms | C7orf21; DULP; HOPS; SB144 |
Locus ID | 83590 |
Cytogenetics | 7q36.1 |
Summary | Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR (PubMed:21343306). Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface (By similarity). Acts as negative regulator of hepatocyte growth during regeneration (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410511 | TMUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427791 | TMUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410511 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 1 |
CNY 3080.00 |
|
LY427791 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2 |
CNY 3080.00 |
|
PH327179 | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) |
CNY 19520.00 |
|
TP307700 | Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP327179 | Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2, 20 µg |
CNY 2900.00 |