TMUB1 (NM_001136044) Human Mass Spec Standard
CAT＃: PH327179
TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516)
View other "TMUB1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227179 |
| Predicted MW | 26.1 kDa |
| Protein Sequence |
>RC227179 representing NM_001136044
Red=Cloning site Green=Tags(s) MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAE TPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQV RLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLL WYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129516 |
| RefSeq ORF | 738 |
| Synonyms | C7orf21; DULP; HOPS; SB144 |
| Locus ID | 83590 |
| Cytogenetics | 7q36.1 |
| Summary | Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR (PubMed:21343306). Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface (By similarity). Acts as negative regulator of hepatocyte growth during regeneration (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410511 | TMUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427791 | TMUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410511 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 1 |
CNY 3080.00 |
|
| LY427791 | Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2 |
CNY 3080.00 |
|
| PH307700 | TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_113622) |
CNY 19520.00 |
|
| TP307700 | Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327179 | Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2, 20 µg |
CNY 2900.00 |
