TM4SF20 (NM_024795) Human Mass Spec Standard
CAT#: PH307725
TM4SF20 MS Standard C13 and N15-labeled recombinant protein (NP_079071)
View other "TM4SF20" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TM4SF20 MS Standard C13 and N15-labeled recombinant protein (NP_079071) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207725 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC207725 protein sequence
Red=Cloning site Green=Tags(s) MTCCEGWTSCNGFSLLVLLLLGVVLNVIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSL TARKRACCNNRTGMFLSSFFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPES FNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQI VIGFLGCLCGVSKRRSQIV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079071 |
RefSeq Size | 2310 |
RefSeq ORF | 687 |
Synonyms | PRO994; SLI5; TCCE518 |
Locus ID | 79853 |
Cytogenetics | 2q36.3 |
Summary | The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Knockout of the homologous gene in mouse results in a neurobehavioral phenotype with suggested enhanced motor coordination. A deletion mutation in the human gene is associated with specific language impairment-5. [provided by RefSeq, Jul 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411055 | TM4SF20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411055 | Transient overexpression lysate of transmembrane 4 L six family member 20 (TM4SF20) |
CNY 3080.00 |
|
TP307725 | Recombinant protein of human transmembrane 4 L six family member 20 (TM4SF20), 20 µg |
CNY 2900.00 |
其它TM4SF20产品