TM4SF20 (NM_024795) Human Recombinant Protein
CAT#: TP307725
Recombinant protein of human transmembrane 4 L six family member 20 (TM4SF20), 20 µg
View other "TM4SF20" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207725 protein sequence
Red=Cloning site Green=Tags(s) MTCCEGWTSCNGFSLLVLLLLGVVLNVIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSL TARKRACCNNRTGMFLSSFFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPES FNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQI VIGFLGCLCGVSKRRSQIV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079071 |
| Locus ID | 79853 |
| UniProt ID | Q53R12 |
| Refseq Size | 2310 |
| Cytogenetics | 2q36.3 |
| Refseq ORF | 687 |
| Synonyms | PRO994; SLI5; TCCE518 |
| Summary | The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Knockout of the homologous gene in mouse results in a neurobehavioral phenotype with suggested enhanced motor coordination. A deletion mutation in the human gene is associated with specific language impairment-5. [provided by RefSeq, Jul 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411055 | TM4SF20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411055 | Transient overexpression lysate of transmembrane 4 L six family member 20 (TM4SF20) |
CNY 3080.00 |
|
| PH307725 | TM4SF20 MS Standard C13 and N15-labeled recombinant protein (NP_079071) |
CNY 19520.00 |
其它TM4SF20产品
