FASTK (NM_033015) Human Mass Spec Standard
CAT#: PH307877
FASTK MS Standard C13 and N15-labeled recombinant protein (NP_148936)
View other "FASTK" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FASTK MS Standard C13 and N15-labeled recombinant protein (NP_148936) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207877 |
Predicted MW | 45.9 kDa |
Protein Sequence |
>RC207877 protein sequence
Red=Cloning site Green=Tags(s) MRRPRGEPGPRAPRPTEGATCAGPGESCFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAALS CPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLV LPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPHA LIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQD LTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDG RVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_148936 |
RefSeq Size | 1448 |
RefSeq ORF | 1224 |
Synonyms | FAST |
Locus ID | 10922 |
Cytogenetics | 7q36.1 |
Summary | The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409778 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416471 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409778 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 4 |
CNY 3080.00 |
|
LY416471 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 1 |
CNY 3080.00 |
|
TP307877 | Recombinant protein of human Fas-activated serine/threonine kinase (FASTK), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP762102 | Purified recombinant protein of Human Fas-activated serine/threonine kinase (FASTK), transcript variant 1,Leu200-Gln535, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 1948.00 |
|
TP762537 | Purified recombinant protein of Human Fas-activated serine/threonine kinase (FASTK), transcript variant 1, 50ug |
CNY 2480.00 |