FASTK (NM_033015) Human Recombinant Protein
CAT＃: TP307877
Recombinant protein of human Fas-activated serine/threonine kinase (FASTK), transcript variant 4, 20 µg
View other "FASTK" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207877 protein sequence
Red=Cloning site Green=Tags(s) MRRPRGEPGPRAPRPTEGATCAGPGESCFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAALS CPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLV LPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPHA LIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQD LTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDG RVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_148936 |
| Locus ID | 10922 |
| UniProt ID | Q14296 |
| Refseq Size | 1448 |
| Cytogenetics | 7q36.1 |
| Refseq ORF | 1224 |
| Synonyms | FAST |
| Summary | The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409778 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416471 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409778 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 4 |
CNY 3080.00 |
|
| LY416471 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 1 |
CNY 3080.00 |
|
| PH307877 | FASTK MS Standard C13 and N15-labeled recombinant protein (NP_148936) |
CNY 19520.00 |
|
| TP762102 | Purified recombinant protein of Human Fas-activated serine/threonine kinase (FASTK), transcript variant 1,Leu200-Gln535, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 1948.00 |
|
| TP762537 | Purified recombinant protein of Human Fas-activated serine/threonine kinase (FASTK), transcript variant 1, 50ug |
CNY 2480.00 |
