IGJ (JCHAIN) (NM_144646) Human Mass Spec Standard
CAT#: PH307932
IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207932 |
| Predicted MW | 18.1 kDa |
| Protein Sequence |
>RC207932 protein sequence
Red=Cloning site Green=Tags(s) MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY GGETKMVETALTPDACYPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_653247 |
| RefSeq Size | 1413 |
| RefSeq ORF | 477 |
| Synonyms | IGCJ; IGJ; JCH |
| Locus ID | 3512 |
| Cytogenetics | 4q13.3 |
| Summary | Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403400 | IGJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403400 | Transient overexpression lysate of immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ) |
CNY 3080.00 |
|
| TP307932 | Recombinant protein of human immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ), 20 µg |
CNY 2900.00 |
