IGJ (JCHAIN) (NM_144646) Human Recombinant Protein
CAT#: TP307932
Recombinant protein of human immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207932 protein sequence
Red=Cloning site Green=Tags(s) MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY GGETKMVETALTPDACYPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_653247 |
| Locus ID | 3512 |
| UniProt ID | P01591 |
| Refseq Size | 1413 |
| Cytogenetics | 4q13.3 |
| Refseq ORF | 477 |
| Synonyms | IGCJ; IGJ; JCH |
| Summary | Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403400 | IGJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403400 | Transient overexpression lysate of immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ) |
CNY 3080.00 |
|
| PH307932 | IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247) |
CNY 19520.00 |
