VPS4B (NM_004869) Human Mass Spec Standard
CAT#: PH308019
VPS4B MS Standard C13 and N15-labeled recombinant protein (NP_004860)
View other "VPS4B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | VPS4B MS Standard C13 and N15-labeled recombinant protein (NP_004860) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208019 |
| Predicted MW | 49.3 kDa |
| Protein Sequence |
>RC208019 protein sequence
Red=Cloning site Green=Tags(s) MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAE KLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLE GAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLG ESEKLVKNLFQLARENKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNI PWVLDSAIRRRFEKRIYIPLPEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALM QPVRKVQSATHFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN TKPTVNEHDLLKLKKFTEDFGQEG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004860 |
| RefSeq Size | 3396 |
| RefSeq ORF | 1332 |
| Synonyms | MIG1; SKD1; SKD1B; VPS4-2 |
| Locus ID | 9525 |
| Cytogenetics | 18q21.33 |
| Summary | The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. Mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be a yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 18; the gene for the other resides on chromosome 16. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401522 | VPS4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401522 | Transient overexpression lysate of vacuolar protein sorting 4 homolog B (S. cerevisiae) (VPS4B) |
CNY 3080.00 |
|
| TP308019 | Recombinant protein of human vacuolar protein sorting 4 homolog B (S. cerevisiae) (VPS4B), 20 µg |
CNY 2900.00 |
