E2F1 (NM_005225) Human Mass Spec Standard
CAT#: PH308247
E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216)
View other "E2F1" proteins (3)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
| Cited in 1 publication. | 
Specifications
| Product Data | |
| Description | E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC208247 | 
| Predicted MW | 46.7 kDa | 
| Protein Sequence | >RC208247 representing NM_005225 Red=Cloning site Green=Tags(s) MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_005216 | 
| RefSeq Size | 2486 | 
| RefSeq ORF | 1311 | 
| Synonyms | E2F-1; RBAP1; RBBP3; RBP3 | 
| Locus ID | 1869 | 
| Cytogenetics | 20q11.22 | 
| Summary | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Transcription Factors | 
| Protein Pathways | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Non-overlapping Control of Transcriptome by Promoter- and Super-Enhancer-Associated Dependencies in Multiple Myeloma
                                                ,null,
                                                Cell reports
                                                ,PubMed ID 30590042
                                                [E2F1] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC417432 | E2F1 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY417432 | Transient overexpression lysate of E2F transcription factor 1 (E2F1) | CNY 3080.00 | |
| TP308247 | Recombinant protein of human E2F transcription factor 1 (E2F1), 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        

 
        