E2F1 (NM_005225) Human Recombinant Protein
CAT#: TP308247
Recombinant protein of human E2F transcription factor 1 (E2F1), 20 µg
View other "E2F1" proteins (3)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC208247 representing NM_005225 Red=Cloning site Green=Tags(s) MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 46.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | WB standard (PMID: 26639898) | 
| Reference Data | |
| RefSeq | NP_005216 | 
| Locus ID | 1869 | 
| UniProt ID | Q01094 | 
| Refseq Size | 2486 | 
| Cytogenetics | 20q11.22 | 
| Refseq ORF | 1311 | 
| Synonyms | E2F-1; RBAP1; RBBP3; RBP3 | 
| Summary | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Transcription Factors | 
| Protein Pathways | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Recruitment of Pontin/Reptin by E2f1 amplifies E2f transcriptional response during cancer progression
                                                ,Tarangelo, A;Lo, N;Teng, R;Kim, E;Le, L;Watson, D;Furth, EE;Raman, P;Ehmer, U;Viatour, P;,
                                                Nat Commun
                                                ,PubMed ID 26639898
                                                [E2F1] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC417432 | E2F1 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY417432 | Transient overexpression lysate of E2F transcription factor 1 (E2F1) | CNY 3080.00 | |
| PH308247 | E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216) | CNY 19520.00 | 


 
                        
 
        