GNG7 (NM_052847) Human Mass Spec Standard
CAT#: PH308768
GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079)
View other "GNG7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208768 |
| Predicted MW | 7.5 kDa |
| Protein Sequence |
>RC208768 protein sequence
Red=Cloning site Green=Tags(s) MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_443079 |
| RefSeq Size | 4264 |
| RefSeq ORF | 204 |
| Locus ID | 2788 |
| Cytogenetics | 19p13.3 |
| Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409457 | GNG7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409457 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 7 (GNG7) |
CNY 3080.00 |
|
| TP308768 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 7 (GNG7), 20 µg |
CNY 2900.00 |
