GNG7 (NM_052847) Human Recombinant Protein
CAT#: TP308768
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 7 (GNG7), 20 µg
View other "GNG7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208768 protein sequence
Red=Cloning site Green=Tags(s) MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_443079 |
| Locus ID | 2788 |
| UniProt ID | O60262 |
| Refseq Size | 4264 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 204 |
| Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409457 | GNG7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409457 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 7 (GNG7) |
CNY 3080.00 |
|
| PH308768 | GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079) |
CNY 19520.00 |


