Methionine Sulfoxide Reductase A (MSRA) (NM_012331) Human Mass Spec Standard
CAT#: PH308916
MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463)
View other "Methionine Sulfoxide Reductase A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208916 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC208916 protein sequence
Red=Cloning site Green=Tags(s) MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ YLSKNPNGYCGLGGTGVSCPVGIKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036463 |
RefSeq Size | 1543 |
RefSeq ORF | 705 |
Synonyms | PMSR |
Locus ID | 4482 |
Cytogenetics | 8p23.1 |
Summary | This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415828 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427660 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427661 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415828 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 1 |
CNY 3080.00 |
|
LY427660 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 2 |
CNY 3080.00 |
|
LY427661 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 3 |
CNY 3080.00 |
|
TP308916 | Recombinant protein of human methionine sulfoxide reductase A (MSRA), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Methionine Sulfoxide Reductase A产品