Methionine Sulfoxide Reductase A (MSRA) (NM_012331) Human Recombinant Protein
CAT#: TP308916
Recombinant protein of human methionine sulfoxide reductase A (MSRA), transcript variant 1, 20 µg
View other "Methionine Sulfoxide Reductase A" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208916 protein sequence
Red=Cloning site Green=Tags(s) MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ YLSKNPNGYCGLGGTGVSCPVGIKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036463 |
Locus ID | 4482 |
UniProt ID | Q9UJ68 |
Refseq Size | 1543 |
Cytogenetics | 8p23.1 |
Refseq ORF | 705 |
Synonyms | PMSR |
Summary | This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415828 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427660 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427661 | MSRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415828 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 1 |
CNY 3080.00 |
|
LY427660 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 2 |
CNY 3080.00 |
|
LY427661 | Transient overexpression lysate of methionine sulfoxide reductase A (MSRA), transcript variant 3 |
CNY 3080.00 |
|
PH308916 | MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463) |
CNY 19520.00 |
其它Methionine Sulfoxide Reductase A产品