Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Mass Spec Standard
CAT#: PH308964
SBDS MS Standard C13 and N15-labeled recombinant protein (NP_057122)
View other "Shwachman Bodian Diamond syndrome" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SBDS MS Standard C13 and N15-labeled recombinant protein (NP_057122) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208964 |
| Predicted MW | 28.8 kDa |
| Protein Sequence |
>RC208964 protein sequence
Red=Cloning site Green=Tags(s) MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057122 |
| RefSeq Size | 1605 |
| RefSeq ORF | 750 |
| Synonyms | CGI-97; SDO1; SDS; SWDS |
| Locus ID | 51119 |
| Cytogenetics | 7q11.21 |
| Summary | This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414234 | SBDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414234 | Transient overexpression lysate of Shwachman-Bodian-Diamond syndrome (SBDS) |
CNY 3080.00 |
|
| TP308964 | Recombinant protein of human Shwachman-Bodian-Diamond syndrome (SBDS), 20 µg |
CNY 2900.00 |
其它Shwachman Bodian Diamond syndrome产品
