Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein
CAT#: TP308964
Recombinant protein of human Shwachman-Bodian-Diamond syndrome (SBDS), 20 µg
View other "Shwachman Bodian Diamond syndrome" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208964 protein sequence
Red=Cloning site Green=Tags(s) MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057122 |
| Locus ID | 51119 |
| UniProt ID | Q9Y3A5 |
| Refseq Size | 1605 |
| Cytogenetics | 7q11.21 |
| Refseq ORF | 750 |
| Synonyms | CGI-97; SDO1; SDS; SWDS |
| Summary | This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414234 | SBDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414234 | Transient overexpression lysate of Shwachman-Bodian-Diamond syndrome (SBDS) |
CNY 3080.00 |
|
| PH308964 | SBDS MS Standard C13 and N15-labeled recombinant protein (NP_057122) |
CNY 19520.00 |
其它Shwachman Bodian Diamond syndrome产品
