Collagen IX (COL9A1) (NM_078485) Human Mass Spec Standard
CAT#: PH309473
COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_511040)
View other "Collagen IX" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_511040) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209473 |
| Predicted MW | 64.4 kDa |
| Protein Sequence |
>RC209473 protein sequence
Red=Cloning site Green=Tags(s) MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKP GAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGD PGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQ GELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEG ARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGA PGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMK GDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPG PRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPGRPGPPGPPGP PGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASYGRNGR DGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQAGQRAFNKGPDP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_511040 |
| RefSeq Size | 3073 |
| RefSeq ORF | 2034 |
| Synonyms | DJ149L1.1.2; EDM6; MED; STL4 |
| Locus ID | 1297 |
| Cytogenetics | 6q13 |
| Summary | This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409192 | COL9A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419709 | COL9A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409192 | Transient overexpression lysate of collagen, type IX, alpha 1 (COL9A1), transcript variant 2 |
CNY 3080.00 |
|
| LY419709 | Transient overexpression lysate of collagen, type IX, alpha 1 (COL9A1), transcript variant 1 |
CNY 4840.00 |
|
| PH318130 | COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_001842) |
CNY 19520.00 |
|
| TP309473 | Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318130 | Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Collagen IX产品


